PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10010260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 343aa    MW: 36576.4 Da    PI: 9.3434
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10010260genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.24.5e-191257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd++l ++v ++G+++W++I++ ++ gR++k+c++rw + 
      Lus10010260 12 KGPWSPEEDKKLHNLVDKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57
                     79******************************.***********985 PP

2Myb_DNA-binding52.51.1e-1666108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
      Lus10010260  66 AFTAEEDDTIIRAHARFGNK-WATIARLLH-GRTDNAIKNHWNST 108
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.945762IPR017930Myb domain
SuperFamilySSF466893.45E-3110105IPR009057Homeodomain-like
SMARTSM007177.9E-171160IPR001005SANT/Myb domain
PfamPF002496.9E-191257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-261365IPR009057Homeodomain-like
CDDcd001672.36E-161456No hitNo description
SMARTSM007179.1E-1463111IPR001005SANT/Myb domain
PROSITE profilePS5129419.98964113IPR017930Myb domain
PfamPF002493.0E-1466108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-2366112IPR009057Homeodomain-like
CDDcd001674.97E-1166109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MAFTGKEIDQ IKGPWSPEED KKLHNLVDKH GPRNWSLISK SIPGRSGKSC RLRWCNQLSP  60
QVEHRAFTAE EDDTIIRAHA RFGNKWATIA RLLHGRTDNA IKNHWNSTLK RKCSSSSEGY  120
DGNLGDCCQP LKRSMSAGSG LPVSTGLTMN PGSPSGSDVS DFSSVPLPPP QPSVLLPPPP  180
PPASTSASHV FRPVPRTGGV APPPETKLSN NRNDDDLATS LSLSLPGTDS SSEVSTPRAP  240
EAAHLHQKQQ HKPVVSVTLP PLPAMNRPVG MDIQGPSEMG LEFMSVIQDM IKMEVRSYMM  300
EQRQGVAGGG GNVGGGMCFQ AAGGSGFRNV AAVKRVGVGK IE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-41111123104MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-41111123104C-Myb DNA-Binding Domain
1msf_C5e-41111123104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002524926.11e-132PREDICTED: transcription factor MYB44
SwissprotQ9FDW19e-95MYB44_ARATH; Transcription factor MYB44
TrEMBLB9SG071e-132B9SG07_RICCO; R2r3-myb transcription factor, putative
STRINGPOPTR_0007s10490.11e-129(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-84myb domain protein 73